PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla008574
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family SRS
Protein Properties Length: 322aa    MW: 33040.3 Da    PI: 8.3346
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla008574genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702218.61.3e-671052593153
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkelet 102
                s t++CqdCGnqakkdC+h+RCRtCC+srgfdCathvkstWvpaa+rrerq ++ +a++ a +s +++ +k++r     +++++s+t++s+++++++l+t
  Cla008574 105 SATTTCQDCGNQAKKDCSHRRCRTCCRSRGFDCATHVKSTWVPAARRRERQLMAVTATAAAGSSGSTSGAKKPRLI---ASQTTSHTSTSNTTPPRSLDT 201
                6789**********************************************99999999999998899999999986...667788899999999999999 PP

     DUF702 103 ss.......lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                ss       lP++v+++avf+cvrv++vddg++e+aYq++v+igGhvfkG+LydqG+e
  Cla008574 202 SSnagfkeaLPSQVQARAVFKCVRVTAVDDGDDEYAYQAVVKIGGHVFKGFLYDQGVE 259
                9999****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.8E-62107259IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.7E-26109151IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.9E-29211258IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MSDPHSLAVS NPATALGVGV GVGVIPLLTA GPCLGVEEDN LLGNRSSSRG GGIQLWQQNQ  60
QSSQHYLKKT ASSSLDHHLH NASATNNELI GGGIGGSSGL ASSTSATTTC QDCGNQAKKD  120
CSHRRCRTCC RSRGFDCATH VKSTWVPAAR RRERQLMAVT ATAAAGSSGS TSGAKKPRLI  180
ASQTTSHTST SNTTPPRSLD TSSNAGFKEA LPSQVQARAV FKCVRVTAVD DGDDEYAYQA  240
VVKIGGHVFK GFLYDQGVEA GDGFPNVSEL HLGDGGGGSR NNRNGSSSSP LVDPSDVYNA  300
AASGGGGVPG FLAGSNYGNQ IS
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818421e-105LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022.
GenBankLN7132591e-105LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449658.11e-149PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like isoform X1
SwissprotQ94CK97e-84LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A0A0KF011e-147A0A0A0KF01_CUCSA; Uncharacterized protein
STRINGVIT_06s0009g03450.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-56Lateral root primordium (LRP) protein-related